Ifoodie / 愛食尚

Robots.txt Information

Robot	Path	Permission
GoogleBot	/	✘
BingBot	/	✘
BaiduSpider	/	✘
YandexBot	/	✘

Meta Tags

Title	愛食尚
Description
Keywords

Server Information

WebSite	www.ifoodie.com.tw
Host IP	104.21.39.168
Location	United States

Related Websites

                    Site
                    Rank
                

More to Explore

ravenhawksmagickalmysticalplaces.com

Ifoodie.com.tw Valuation

US$361,153

Last updated: Dec 24, 2022

Ifoodie.com.tw has global traffic rank of 240,133. Ifoodie.com.tw has an estimated worth of US$ 361,153, based on its estimated Ads revenue. Ifoodie.com.tw receives approximately 13,192 unique visitors each day. Its web server is located in United States, with IP address 104.21.39.168. According to SiteAdvisor, ifoodie.com.tw is unknown to visit.

Traffic & Worth Estimates

Purchase/Sale Value	US$361,153
Daily Ads Revenue	US$197
Monthly Ads Revenue	US$5,936
Yearly Ads Revenue	US$72,230
Daily Unique Visitors	13,192
Note: All traffic and earnings values are estimates.

Traffic Ranks

Global Rank	240,133
Delta (90 Days)	0
Most Popular In Country	N/A
Country Rank	N/A

DNS Records

Host	Type	TTL	Data
ifoodie.com.tw	A	300	IP: 104.21.39.168
ifoodie.com.tw	A	300	IP: 172.67.146.199
ifoodie.com.tw	AAAA	300	IPv6: 2606:4700:3033:0:0:0:6815:27a8
ifoodie.com.tw	AAAA	300	IPv6: 2606:4700:3033:0:0:0:ac43:92c7
ifoodie.com.tw	MX	3600	Priority: 0 Target: ifoodie-com-tw.mail.protection.outlook.com.
ifoodie.com.tw	NS	21600	Target: kyle.ns.cloudflare.com.
ifoodie.com.tw	NS	21600	Target: karina.ns.cloudflare.com.
ifoodie.com.tw	TXT	300	TXT: MS=ms99916288
ifoodie.com.tw	TXT	300	TXT: nn036eh13f2rk1d00f1m7rc964
ifoodie.com.tw	TXT	300	TXT: v=spf1 include:spf.protection.outlook.com -all
ifoodie.com.tw	SOA	3600	MNAME: karina.ns.cloudflare.com. RNAME: dns.cloudflare.com. Serial: 2295521397 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600

HTTP Headers

HTTP/1.1 200 OK
Date: Sat, 24 Dec 2022 20:49:48 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: PHPSESSID=e4jlvfg96of6qrfpbqu3ngh37c; path=/
Set-Cookie: PHPSESSID=e4jlvfg96of6qrfpbqu3ngh37c; expires=Sun, 25-Dec-2022 04:49:47 GMT; Max-Age=28800; path=/; domain=demo.ifoodie.com.tw; secure; SameSite=None
Set-Cookie: session_id=221225044947577176; expires=Sun, 25-Dec-2022 20:49:47 GMT; Max-Age=86400; path=/
Set-Cookie: haveReadList=%7B%7D; expires=Fri, 20-Oct-2023 20:49:47 GMT; Max-Age=25920000; path=/
Set-Cookie: articleList=%7B%22ifoodie%22%3A%5B%2247%22%2C%2246%22%2C%2245%22%2C%2249%22%2C%2248%22%5D%7D; expires=Fri, 20-Oct-2023 20:49:47 GMT; Max-Age=25920000; path=/
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Vary: Accept-Encoding
Content-Language: en-US
CF-Cache-Status: DYNAMIC
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=G7%2FQmc8bDWpokT5uBs6LX0elM3Ro1G763vmbZzfbv4U9vp1U14bGMD%2BYwE30Ej7ksizD1d9bf%2FLN%2BcEjFlbX6%2B%2F%2BJMQ9GTSNetRUv4ERvEhroEuoO8b0a1bwEKtYcmJK30AQ7wn4S4UUwA1lRA%3D%3D"}],"group":"cf-nel","max_age":604800}
NEL: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 77ec349e2c848c8a-EWR
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400

Ifoodie.com.tw Whois Information

Domain Name: ifoodie.com.tw
   Domain Status: ok
   Registrant:
      整技有限公司
      ITEC
      HUO-CHEN TSAI  monitor@itec.com.tw
      +886.33587899
      +886.33588089
      4F-6, No.1071, Chung-Cheng Rd, Taoyuan City, Taiwan, 330, R.  
      TaoYuan, 
      TW

   Administrative Contact:
      Sung Haun Chieh  service@pumo.com.tw
      +886.282269123
      +886.282269122

   Technical Contact:
      Sung Haun Chieh  service@pumo.com.tw
      +886.282269123
      +886.282269122

   Record expires on 2023-05-03 11:23:16 (UTC+8)
   Record created on 2022-05-03 11:23:16 (UTC+8)

   Domain servers in listed order:
      karina.ns.cloudflare.com     
      kyle.ns.cloudflare.com

Registration Service Provider: PUMO
Registration Service URL: https://www.pumo.com.tw/www/domains/

Ifoodie.com.tw valuation and analysis